PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g02620.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 661aa    MW: 70086.5 Da    PI: 10.5003
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g02620.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57.2e-39432491362
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                    +alkcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+ss
  Zjn_sc00022.1.g02620.1.am.mk 432 PEALKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRSS 491
                                   5789****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-28423484IPR003851Zinc finger, Dof-type
PfamPF027015.5E-33434489IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.525435489IPR003851Zinc finger, Dof-type
PROSITE patternPS013610437473IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MRRHSSDHRS KGDQDLSTTP HVNAVQDNPA EFATAASRTP NTRKEEVAVF CRAMVRSACQ  60
SAAEHGRDRS NGTFAAGMYP AWRCGTVWRD ADDRAFAGAA RPAQGSAARL GERARPLFNG  120
NGLQRAVANA RTPVTACAPA ARTPSANGRP ARDPPTGRPV ARLFACADGQ GLSVGHGRVR  180
RAKAIAPALI WAMRRAGGRA CTSHQRARRA GREQQLPQPP GAVTDRLACP AASSSSSSSG  240
DARPTSWPPG EGIPPRRAAI DRPRSPDWVS EREPAVVLAE FYELMFASIR RSTACQRSEM  300
EKAEVAGSTS PSRKKAEAVD GNERCRFIHA GALPPPGSEH DKPTEIFTGW LVCDPEATPS  360
GWSSRLAALP PTKRYLARRR RLRLLPRAMQ EFQSIPGLAG RLFGGAGASD LYRAHQAQQG  420
PGARCGGVSP APEALKCPRC ESTNTKFCYY NNYNLSQPRH FCKSCRRYWT KGGVLRNVPV  480
GGGCRKAKRS SASAASSTPS TPTSTEAKNP RRAPAPSPRR TSSGRSSPTG LAAAAAPVTP  540
SSSNNIAVTG HSSANPFSTV DVAPPAPIFA DQAAALASLF APPPPPQLPV FSFTAQSNKD  600
EAALVVGQAA RPDDEAASDM APFTSLDAGI FEQLGDASAA AAYWNAGSCW TDVQDPSMYL  660
P
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281323e-85AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK0610003e-85AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
GenBankAK1008923e-85AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
GenBankAK1013213e-85AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAP0052843e-85AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149583e-85AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126103e-85CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.18e-30DOF zinc finger protein 1